PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Oropetium_20150105_23355A
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Cynodonteae; Tripogoninae; Oropetium
Family MYB_related
Protein Properties Length: 377aa    MW: 39806.1 Da    PI: 9.2495
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Oropetium_20150105_23355AgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding39.51.3e-1299143347
                                SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
            Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                                +WT+eE+++++ + ++lG+g+W+ I+r     Rt+ q+ s+ qky
  Oropetium_20150105_23355A  99 AWTEEEHKKFLLGLNKLGKGDWRGISRNYVISRTPTQVASHAQKY 143
                                7*****************************89************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.6972843IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129418.29791148IPR017930Myb domain
SuperFamilySSF466895.98E-1693149IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-1795147IPR006447Myb domain, plants
SMARTSM007171.6E-1096146IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.3E-1098145IPR009057Homeodomain-like
PfamPF002494.3E-1199143IPR001005SANT/Myb domain
CDDcd001678.51E-999144No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000122Biological Processnegative regulation of transcription from RNA polymerase II promoter
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0030307Biological Processpositive regulation of cell growth
GO:0046686Biological Processresponse to cadmium ion
GO:0048366Biological Processleaf development
GO:2000469Biological Processnegative regulation of peroxidase activity
GO:0000976Molecular Functiontranscription regulatory region sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 377 aa     Download sequence    Send to blast
MMRDGAGAAA AAGGGGGGAT AGGGDGPRRC SQCGHHGHNA RTCTARPVKL FGVRIGDKPS  60
IRKCASMGNI AHLAAEGSGA REEGYGSDGE RPHKKRGEAW TEEEHKKFLL GLNKLGKGDW  120
RGISRNYVIS RTPTQVASHA QKYFNRQTNV HRRKRRTSLF DMVEESADQP LSRSSSQEVE  180
QHLDDSQPIL APPAPVVSSA DVVSPAPPLP PVPVEMVTSP TVQVPVPVPV PLVAPQLMEQ  240
DSEASSSSPG EARMVMPEAM PPYVYHPMML PPPYYPPAYI QVPCYGYVPI FYRPPSAAQA  300
PHEVVKPVAV HSKPPVNVND LYSMSELSLK GESSANGGVP ASPLPPKPVG RPDRQSAFHG  360
KGPPGGSSGG LISAVK*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00551DAPTransfer from AT5G47390Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001151255.11e-174uncharacterized protein LOC100284888
TrEMBLB4FLJ61e-174B4FLJ6_MAIZE; DNA binding protein
STRINGGRMZM2G112764_P011e-173(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP129002629
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G47390.11e-44MYB_related family protein